PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0409s0070.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 343aa    MW: 37105.1 Da    PI: 8.1444
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0409s0070.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.22.1e-393592562
                  zf-Dof  5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             l+cprCds ntkfCyynnysl+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk +
  SapurV1A.0409s0070.1.p 35 DLNCPRCDSPNTKFCYYNNYSLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKIK 92
                            689****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088429.3573690IPR003851Zinc finger, Dof-type
ProDomPD0074781.0E-253690IPR003851Zinc finger, Dof-type
PfamPF027014.5E-333690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MMPPNNFQAK QASFDDNQIS ISNRKTTTTR PQEVDLNCPR CDSPNTKFCY YNNYSLTQPR  60
HFCKTCRRYW TKGGALRNVP IGGGCRKNKK IKSSTRLSGD SSGSSEIGGF NFFHGLSPVV  120
DFNLGGLSFP RLSPSPNGIY NHFPSFGDIS ATSEAAVSVT SPRFRLDPSG SSTAGSGSGS  180
LTGFSYPLTS VSSGFCGASQ ENIGGASMNV NSNLAYSIES LSCINQDLHW KLQQQRLAML  240
FGAGKNDHKD VSTVLTGPIE NHIQKLQPMM FENLEISKPQ VCAAGNSRKD GETSGDPSTE  300
WFLGNSYAPV IATPTNRSNI GNDDYTGNWD GVQAWGDLNH YI*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011006491.10.0PREDICTED: dof zinc finger protein DOF5.7-like
TrEMBLB9H6Q90.0B9H6Q9_POPTR; Uncharacterized protein
STRINGPOPTR_0005s19310.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF38543460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-34TARGET OF MONOPTEROS 6